PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof014910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family DBB
Protein Properties Length: 204aa    MW: 21023.4 Da    PI: 6.1027
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-3972PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.79.8e-084486541
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  Sof014910 44 QCDACEAAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 86
               7******99*********************6678888898877 PP

2zf-B_box29.12.1e-0996127334
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeH 34 
                 ++C+ ++ek++ +fC +++ l+C+dC + +H
  Sof014910  96 LPRCDVCQEKPAFIFCVEDRALFCRDCDEPIH 127
                689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.8E-114087IPR000315B-box-type zinc finger
PROSITE profilePS501199.8834087IPR000315B-box-type zinc finger
PfamPF006432.1E-54487IPR000315B-box-type zinc finger
PROSITE profilePS501198.60394141IPR000315B-box-type zinc finger
SMARTSM003363.4E-1494141IPR000315B-box-type zinc finger
PfamPF006432.9E-796137IPR000315B-box-type zinc finger
CDDcd000215.15E-897127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
XPGLPVSSGS REAPDYVRPE SWVCRRAAEA RRGEGRGGGG MRIQCDACEA AAATVVCCAD  60
EAALCARCDV EIHAANKLAS KHQRLPLGDG DAAPSLPRCD VCQEKPAFIF CVEDRALFCR  120
DCDEPIHVPG TLSGNHQRYL ATGIRVGFSS VCGAAGAEGI PPAAAAKGGS NPGPAAGATK  180
TTTGKDTLPE EVPSFAFLPP SGWA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.114240.0crown| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976063.11e-82PREDICTED: B-box zinc finger protein 24-like
SwissprotQ962884e-54BBX24_ARATH; B-box zinc finger protein 24
TrEMBLK3Y9J21e-82K3Y9J2_SETIT; Uncharacterized protein
STRINGSi010884m3e-82(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.22e-39DBB family protein